CHMP4B anticorps (Middle Region)

N° du produit ABIN633066

Cet anticorps anti-CHMP4B est un anticorps Lapin Polyclonal détectant CHMP4B dans WB. Adapté pour Humain.

Aperçu rapide pour CHMP4B anticorps (Middle Region) (ABIN633066)

Antigène: CHMP4B (Charged Multivesicular Body Protein 4B (CHMP4B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHMP4B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CHMP4B anticorps

Épitope: Middle Region

Specificité: CHMP4 B antibody was raised against the middle region of CHMP4

Purification: Affinity purified

Immunogène: CHMP4 B antibody was raised using the middle region of CHMP4 corresponding to a region with amino acids RKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHMP4B Blocking Peptide, (ABIN5612852), is also available for use as a blocking control in assays to test for specificity of this CHMP4B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHMP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHMP4B

Antigène: CHMP4B (Charged Multivesicular Body Protein 4B (CHMP4B))

Autre désignation: CHMP4B

Sujet: This gene encodes a member of the chromatin-modifying protein/charged multivesicular body protein (CHMP) protein family. The protein is part of the endosomal sorting complex required for transport (ESCRT) complex III (ESCRT-III), which functions in the sorting of endocytosed cell-surface receptors into multivesicular endosomes. The ESCRT machinery also functions in the final abscisson stage of cytokinesis and in the budding of enveloped viruses such as HIV-1. The three proteins of the CHMP4 subfamily interact with programmed cell death 6 interacting protein (PDCD6IP, also known as ALIX), which also functions in the ESCRT pathway. The CHMP4 proteins assemble into membrane-attached 5-nm filaments that form circular scaffolds and promote or stabilize outward budding. These polymers are proposed to help generate the luminal vesicles of multivesicular bodies. Mutations in this gene result in autosomal dominant posterior polar cataracts.

Poids moléculaire: 25 kDa (MW of target protein)